Il22 (NM_016971) Mouse Recombinant Protein

CAT#: TP723220

Purified recombinant protein of Mouse interleukin 22 (Il22).

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
• Tag: Tag Free
• Predicted MW: 22.4 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Assay#1: Determined by its ability to activate STAT following receptor ligand interaction. Assay#2:Measured by its ability to induce IL-10 secretion in COLO 205 (human colon carcinoma cells). The expected ED50 for this effect is 1.0-2.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_058667
• Locus ID: 50929
• UniProt ID: Q9JJY9
• Cytogenetics: 10 66.67 cM
• Refseq Size: 1088
• Refseq ORF: 540
• Synonyms: IL-22; IL-22a; Iltif; ILTIFa
• Summary: Cytokine that contributes to the inflammatory response in vivo. [UniProtKB/Swiss-Prot Function]