Il1f5 (NM_019451) Mouse Recombinant Protein

CAT#: TP723230

Purified recombinant protein of Mouse interleukin 1 family, member 5 (delta) (Il1f5), transcript variant 2.

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD
• Tag: Tag Free
• Predicted MW: 17 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Measured by its ability to inhibit IL-36γ induced IL-6 production by human PBMCs.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_062324
• Locus ID: 54450
• UniProt ID: Q9QYY1
• Cytogenetics: 2 16.31 cM
• Refseq Size: 1759
• Refseq ORF: 468
• Synonyms: AI413231; Fil1delta; Il-1h3; IL-36Ra; Il1hy1; IL36RN