IL36 beta (IL36B) (NM_173178) Human Recombinant Protein
CAT#: TP723231
Purified recombinant protein of Human interleukin 1 family, member 8 (eta) (IL1F8), transcript variant 2.
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE
|
Tag | Tag Free |
Predicted MW | 17.3 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Measured by its ability to induce IL-8 production by human PBMCs. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_775270 |
Locus ID | 27177 |
UniProt ID | Q9NZH7 |
Cytogenetics | 2q14.1 |
Refseq Size | 1068 |
Refseq ORF | 471 |
Synonyms | FIL1; FIL1-(ETA); FIL1H; FILI-(ETA); IL-1F8; IL-1H2; IL1-ETA; IL1F8; IL1H2 |
Summary | The protein encoded by this gene is a member of the interleukin 1 cytokine family. Protein structure modeling indicated that this cytokine may contain a 12-stranded beta-trefoil structure that is conserved between IL1A (IL-A alpha) and IL1B (IL-1 beta). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406635 | IL36B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY406635 | Transient overexpression lysate of interleukin 1 family, member 8 (eta) (IL1F8), transcript variant 2 |
USD 396.00 |
|
PH311037 | IL1F8 MS Standard C13 and N15-labeled recombinant protein (NP_775270) |
USD 2,055.00 |
|
TP311037 | Recombinant protein of human interleukin 1 family, member 8 (eta) (IL1F8), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review