Il7 (NM_008371) Mouse Recombinant Protein

CAT#: TP723244

Purified recombinant protein of Mouse interleukin 7 (Il7).

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
• Tag: Tag Free
• Predicted MW: 15 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: The ED50 as determined by the dose-dependent stimulation of the proliferation of murine 2E8 cells is< 0.2 ng/ml, corresponding to a specific activity of≥ 5 x 10^6 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_032397
• Locus ID: 16196
• UniProt ID: P10168, Q544C8
• Cytogenetics: 3 2.02 cM
• Refseq Size: 2475
• Refseq ORF: 462
• Synonyms: A630026I06Rik; hlb368; Il-7
• Summary: The protein encoded by this gene is a hematopoietic growth factor important for B and T cell development. Alternative splicing results in several transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015]