CXCL11 (NM_005409) Human Recombinant Protein
CAT#: TP723255
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 11 (CXCL11).
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
|
Tag | Tag Free |
Predicted MW | 8.3 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to chemoattract IL-2 activated T-cells using a concentration range of 0.1-10.0 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005400 |
Locus ID | 6373 |
UniProt ID | O14625 |
Cytogenetics | 4q21.1 |
Refseq Size | 1610 |
Refseq ORF | 282 |
Synonyms | b-R1; H174; I-TAC; IP-9; IP9; SCYB9B; SCYB11 |
Summary | 'Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This antimicrobial gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2014]' |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Toll-like receptor signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP700205 | Recombinant protein of human chemokine (C-X-C motif) ligand 11 (CXCL11), 20 ug |
USD 748.00 |
|
TP700206 | Recombinant protein of human chemokine (C-X-C motif) ligand 11 (CXCL11), 20 ug |
USD 748.00 |
|
TP723740 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 11 (CXCL11 / ITAC) |
USD 190.00 |
{0} Product Review(s)
Be the first one to submit a review