Cxcl11 (NM_019494) Mouse Recombinant Protein

CAT#: TP723256

Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 11 (Cxcl11), transcript variant 1.

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
• Tag: Tag Free
• Predicted MW: 9 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to chemoattract murine CXCR3 transfected HEK/293 cells using a concentration range of 10.0-100.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_062367
• Locus ID: 56066
• UniProt ID: Q9JHH5
• Cytogenetics: 5 E2
• Refseq Size: 1597
• Refseq ORF: 300
• Synonyms: b-R1; betaR1; Cxc11; H174; I-tac; Ip9; Itac; Scyb9b; Scyb11