Cxcl11 (NM_019494) Mouse Recombinant Protein
CAT#: TP723256
Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 11 (Cxcl11), transcript variant 1.
Product Images
Other products for "Cxcl11"
Specifications
Product Data | |
Species | Mouse |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
|
Tag | Tag Free |
Predicted MW | 9 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to chemoattract murine CXCR3 transfected HEK/293 cells using a concentration range of 10.0-100.0 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_062367 |
Locus ID | 56066 |
UniProt ID | Q9JHH5 |
Cytogenetics | 5 E2 |
Refseq Size | 1597 |
Refseq ORF | 300 |
Synonyms | b-R1; betaR1; Cxc11; H174; I-tac; Ip9; Itac; Scyb9b; Scyb11 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP723767 | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 11 (Cxcl11 / ITAC), transcript variant 1 |
USD 205.00 |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.