Lep (NM_008493) Mouse Recombinant Protein

CAT#: TP723268

Purified recombinant protein of Mouse leptin (Lep).

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
• Tag: Tag Free
• Predicted MW: 16.2 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: PeproTech's murine Leptin has been shown to be biologically active in two different mouse obesity models, ob/ob and NZO. Both strains of mice were treated via intraperitoneal injection once daily at a dose of 5 ug Leptin/gm of body weight for 14 days. Significant effects on body weight , food consumption, and plasma glucose levels were observed to saline-treated controls
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_032519
• Locus ID: 16846
• UniProt ID: P41160, Q544U0
• Cytogenetics: 6 12.3 cM
• Refseq Size: 3257
• Refseq ORF: 504
• Synonyms: ob; obese