LIGHT (TNFSF14) (NM_003807) Human Recombinant Protein
CAT#: TP723271
Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1.
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | Hi-5 insect |
Expression cDNA Clone or AA Sequence |
RLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
|
Tag | Tag Free |
Predicted MW | 19.3 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its cytotoxic effect on HT-29 cells (human colon adenocarcinoma cells) in the presence of human IFN-gamma. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003798 |
Locus ID | 8740 |
UniProt ID | O43557 |
Cytogenetics | 19p13.3 |
Refseq Size | 1491 |
Refseq ORF | 720 |
Synonyms | CD258; HVEML; LIGHT; LTg |
Summary | The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418409 | TNFSF14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY418409 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1 |
USD 325.00 |
|
PH317759 | TNFSF14 MS Standard C13 and N15-labeled recombinant protein (NP_003798) |
USD 2,055.00 |
|
TP317759 | Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1 |
USD 399.00 |
{0} Product Review(s)
Be the first one to submit a review