Ccl7 (NM_013654) Mouse Recombinant Protein

CAT#: TP723285

Purified recombinant protein of Mouse chemokine (C-C motif) ligand 7 (Ccl7).

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
• Tag: Tag Free
• Predicted MW: 8.5 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to chemoattract Balb/C mouse spleen MNCs using a concentration range of 10.0-100.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_038682
• Locus ID: 20306
• UniProt ID: Q03366, A9Z1Z1
• Cytogenetics: 11 49.83 cM
• Refseq Size: 911
• Refseq ORF: 291
• Synonyms: fic; marc; MCP-3; mcp3; Scya7