Ccl28 (NM_020279) Mouse Recombinant Protein

CAT#: TP723295

Purified recombinant protein of Mouse chemokine (C-C motif) ligand 28 (Ccl28).

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  SEAILPMASSCCTEVSHHVSGRLLERVSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNGRENVCSGKKQPSRKDRKGHTTRKHRTRGTHRHEASR
• Tag: Tag Free
• Predicted MW: 12.6 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to chemoattract murine lymphocytes using a concentration range of 1.0-10.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_064675
• Locus ID: 56838
• UniProt ID: Q9JIL2
• Cytogenetics: 13 D2.3
• Refseq Size: 3753
• Refseq ORF: 393
• Synonyms: CCK1; MEC; Scya28