Ccl4 (NM_013652) Mouse Recombinant Protein

CAT#: TP723307

Purified recombinant protein of Mouse chemokine (C-C motif) ligand 4 (Ccl4).

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
• Tag: Tag Free
• Predicted MW: 7.8 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to chemoattract human monocytes using a concentration range of 20.0-100.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_038680
• Locus ID: 20303
• UniProt ID: P14097, Q5QNV9
• Cytogenetics: 11 51.09 cM
• Refseq Size: 674
• Refseq ORF: 279
• Synonyms: Act-2; AT744.1; MIP-1B; Mip1b; Scya4
• Summary: Monokine with inflammatory and chemokinetic properties. [UniProtKB/Swiss-Prot Function]