Nucleobindin 2 (NUCB2) (NM_005013) Human Recombinant Protein

CAT#: TP723327

Purified recombinant protein of Human nucleobindin 2 (NUCB2).

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL
• Tag: Tag Free
• Predicted MW: 9.7 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by an in vivo assay using healthy wild type male mice (C57BL/6J). Mice were treated via intraperitoneal injection once at a dose of 4μg Nesfatin-1/gm of body weight. Significant effects on body weight and food consumption were observed relative to saline-treated controls.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005004
• Locus ID: 4925
• UniProt ID: P80303
• Cytogenetics: 11p15.1
• Refseq Size: 1612
• Refseq ORF: 1260
• Synonyms: HEL-S-109; NEFA
• Summary: 'This gene encodes a protein with a suggested role in calcium level maintenance, eating regulation in the hypothalamus, and release of tumor necrosis factor from vascular endothelial cells. This protein binds calcium and has EF-folding domains. [provided by RefSeq, Oct 2011]'
• Protein Families: Secreted Protein, Transmembrane