Osm (NM_001006961) Rat Recombinant Protein
CAT#: TP723342
Purified recombinant protein of Rat oncostatin M (Osm).
Other products for "Osm"
Specifications
Product Data | |
Species | Rat |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MKRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRRHSPLWAWLKGDHRIRPSRSSQSAMLRSLVPR
|
Tag | Tag Free |
Predicted MW | 24.4 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Assay #1:Determined by its ability to stimulate the proliferation of rat C6 cells. The expected ED50 is 3.0-5.0ug/mL. Assay #2: Determined by its ability to inhibit Alkaline phosphatase activity of differentiated MC3T3 E1 cells. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001006962 |
Locus ID | 289747 |
UniProt ID | Q65Z15 |
Cytogenetics | 14q21 |
Refseq Size | 720 |
Refseq ORF | 717 |
Summary | mouse homolog is a cytokine and an immediate early gene [RGD, Feb 2006] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP526014 | Purified recombinant protein of Mouse oncostatin M (Osm), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug |
USD 748.00 |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.