Osm (NM_001006961) Rat Recombinant Protein

CAT#: TP723342

Purified recombinant protein of Rat oncostatin M (Osm).

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MKRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRRHSPLWAWLKGDHRIRPSRSSQSAMLRSLVPR
• Tag: Tag Free
• Predicted MW: 24.4 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Assay #1:Determined by its ability to stimulate the proliferation of rat C6 cells. The expected ED50 is 3.0-5.0ug/mL. Assay #2: Determined by its ability to inhibit Alkaline phosphatase activity of differentiated MC3T3 E1 cells.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001006962
• Locus ID: 289747
• UniProt ID: Q65Z15
• Cytogenetics: 14q21
• Refseq Size: 720
• Refseq ORF: 717
• Summary: mouse homolog is a cytokine and an immediate early gene [RGD, Feb 2006]