PDGFC (NM_016205) Human Recombinant Protein
CAT#: TP723357
Purified recombinant protein of Human platelet derived growth factor C (PDGFC), transcript variant 1.
Product Images
![](https://cdn.origene.com/img/defaults-img.jpg)
Other products for "PDGFC"
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
|
Tag | Tag Free |
Predicted MW | 25 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by the dose-dependent stimulation of the proliferation of Balb/c 3T3 cells. The expected ED50 for this effect is 15-20 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057289 |
Locus ID | 56034 |
UniProt ID | Q9NRA1 |
Cytogenetics | 4q32.1 |
Refseq Size | 3007 |
Refseq ORF | 1035 |
Synonyms | FALLOTEIN; SCDGF |
Summary | The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines. This gene product appears to form only homodimers. It differs from the platelet-derived growth factor alpha and beta polypeptides in having an unusual N-terminal domain, the CUB domain. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2010] |
Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells |
Protein Pathways | Cytokine-cytokine receptor interaction, Focal adhesion, Gap junction, Melanoma, Prostate cancer, Regulation of actin cytoskeleton |
Documents
FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.