Pspn (NM_008954) Mouse Recombinant Protein

CAT#: TP723361

Purified recombinant protein of Mouse persephin (Pspn).

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  ALAGSCRLWSLTLPVAELGLGYASEEKVIFRYCAGSCPQEARTQHSLVLARLRGRGRAHGRPCCQPTSYADVTFLDDQHHWQQLPQLSAAACGCGG
• Tag: Tag Free
• Predicted MW: 10.3 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 was determined by its ability to stimulate proliferation of human thyroid carcinoma cells (TT cells) is > 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_032980
• Locus ID: 19197
• UniProt ID: A1L3Q1
• Cytogenetics: 17 D
• Refseq Size: 474
• Refseq ORF: 468
• Synonyms: PSP
• Summary: This gene encodes a secreted ligand of the GDNF (glial cell line-derived neurotrophic factor) subfamily and TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine kinase and a GPI-linked coreceptor, and promotes survival of neuronal populations. This protein may play a role in cell death, and nervous system development and function. Mice lacking a functional copy of this gene exhibit hypersensitivity to cerebral ischemia. [provided by RefSeq, Aug 2016]