Pf4 (NM_019932) Mouse Recombinant Protein

CAT#: TP723363

Purified recombinant protein of Mouse platelet factor 4 (Pf4).

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
• Tag: Tag Free
• Predicted MW: 8.2 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to chemoattract human neutrophils using a concentration range of 10.0-100.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_064316
• Locus ID: 56744
• UniProt ID: Q9Z126, Q3TVN6, Q6P8R3
• Cytogenetics: 5 E1
• Refseq Size: 525
• Refseq ORF: 315
• Synonyms: Cxcl4; Scyb4