Pleiotrophin (PTN) (NM_002825) Human Recombinant Protein
CAT#: TP723364
Purified recombinant protein of Human pleiotrophin (PTN).
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
|
Tag | Tag Free |
Predicted MW | 15.4 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002816 |
Locus ID | 5764 |
UniProt ID | P21246, A0A024R778 |
Cytogenetics | 7q33 |
Refseq Size | 1558 |
Refseq ORF | 504 |
Synonyms | HARP; HB-GAM; HBBM; HBGF-8; HBGF8; HBNF; HBNF-1; NEGF1; OSF-1 |
Summary | 'The protein encoded by this gene is a secreted heparin-binding growth factor. The protein has significant roles in cell growth and survival, cell migration, angiogenesis and tumorigenesis. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Oct 2016]' |
Protein Families | Druggable Genome, Phosphatase, Secreted Protein, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401001 | PTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401001 | Transient overexpression lysate of pleiotrophin (PTN) |
USD 396.00 |
|
TP750060 | Purified recombinant protein of Human pleiotrophin (PTN), full length, Tag free, expressed in E. coli, 100ug |
USD 425.00 |
|
TP761129 | Purified recombinant protein of Human pleiotrophin (PTN), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review