Prl (NM_012629) Rat Recombinant Protein

CAT#: TP723371

Purified recombinant protein of Rat prolactin (Prl).


  View other "Prl" proteins (1)

USD 240.00

5 Days*

Size
    • 50 ug

Product Images

Specifications

Product Data
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MLPVCSGGDCQTPLPELFDRVVMLSHYIHTLYTDMFIEFDKQYVQDREFIAKAINDCPTSSLATPEDKEQAQKVPPEVLLNLILSLVHSWNDPLFQLITGLGGIHEAPDAIISRAKEIEEQNKRLLEGIEKIISQAYPEAKGNEIYLVWSQLPSLQGVDEESKDLAFYNNIRCLRRDSHKVDNYLKFLRCQIVHKNNC
Tag Tag Free
Predicted MW 22.6 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to induce the proliferation of rat Nb2-11 cells in the concentration range of 0.1-1.0 ng/ml.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_036761
Locus ID 24683
UniProt ID P01237, B5DEM6
Cytogenetics 17p12
Refseq Size 1016
Refseq ORF 678
Synonyms Gha1; Prl1a1; PRLB; PRLSD1; Prol; RATPRLSD1; RNPROL
Summary induces lactation; may facilitate decidual growth and placentation; promotes prostate epithelial cell proliferation [RGD, Feb 2006]

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.