Prl (NM_012629) Rat Recombinant Protein
CAT#: TP723371
Purified recombinant protein of Rat prolactin (Prl).
Other products for "Prl"
Specifications
Product Data | |
Species | Rat |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MLPVCSGGDCQTPLPELFDRVVMLSHYIHTLYTDMFIEFDKQYVQDREFIAKAINDCPTSSLATPEDKEQAQKVPPEVLLNLILSLVHSWNDPLFQLITGLGGIHEAPDAIISRAKEIEEQNKRLLEGIEKIISQAYPEAKGNEIYLVWSQLPSLQGVDEESKDLAFYNNIRCLRRDSHKVDNYLKFLRCQIVHKNNC
|
Tag | Tag Free |
Predicted MW | 22.6 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to induce the proliferation of rat Nb2-11 cells in the concentration range of 0.1-1.0 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_036761 |
Locus ID | 24683 |
UniProt ID | P01237, B5DEM6 |
Cytogenetics | 17p12 |
Refseq Size | 1016 |
Refseq ORF | 678 |
Synonyms | Gha1; Prl1a1; PRLB; PRLSD1; Prol; RATPRLSD1; RNPROL |
Summary | induces lactation; may facilitate decidual growth and placentation; promotes prostate epithelial cell proliferation [RGD, Feb 2006] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP723370 | Purified recombinant protein of Mouse prolactin (Prl), transcript variant 1. |
USD 240.00 |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.