Retn (NM_022984) Mouse Recombinant Protein

CAT#: TP723383

Purified recombinant protein of Mouse resistin (Retn), transcript variant 1.

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS
• Tag: Tag Free
• Predicted MW: 20.2 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_075360
• Locus ID: 57264
• UniProt ID: Q99P87, Q5BMX4
• Cytogenetics: 8 1.92 cM
• Refseq Size: 1139
• Refseq ORF: 345
• Synonyms: ADSF; Fizz3; Rstn; Xcp4
• Summary: Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes. [UniProtKB/Swiss-Prot Function]