RSPO2 (NM_178565) Human Recombinant Protein
CAT#: TP723386
Purified recombinant protein of Human R-spondin 2 homolog (Xenopus laevis) (RSPO2).
Product Images
![](https://cdn.origene.com/img/defaults-img.jpg)
Specifications
Product Data | |
Species | Human |
Expression Host | CHO |
Expression cDNA Clone or AA Sequence |
ASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPGGKRTPKAKEKRNKKKKRKLIERAQEQHSVFLATDRANQ
|
Tag | Tag Free |
Predicted MW | 24.4 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | R-Spondin-2 enhances BMP-2 mediated differentiation of MC3T3-E1 cells. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_848660 |
Locus ID | 340419 |
UniProt ID | Q6UXX9, B3KVP3 |
Cytogenetics | 8q23.1 |
Refseq Size | 2842 |
Refseq ORF | 729 |
Synonyms | CRISTIN2; HHRRD; TETAMS2 |
Summary | This gene encodes a member of the R-spondin family of proteins. These proteins are secreted ligands of leucine-rich repeat containing G protein-coupled receptors that enhance Wnt signaling through the inhibition of ubiquitin E3 ligases. A chromosomal translocation including this locus that results in the formation of a gene fusion has been identified in multiple human cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403609 | RSPO2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403609 | Transient overexpression lysate of R-spondin 2 homolog (Xenopus laevis) (RSPO2) |
USD 396.00 |
|
TP761966 | Purified recombinant protein of Human R-spondin 2 homolog (Xenopus laevis) (RSPO2),full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
|
TP762051 | Purified recombinant protein of Human R-spondin 2 homolog (Xenopus laevis) (RSPO2),Gln22-End, with N-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review