Kitlg (NM_021843) Rat Recombinant Protein

CAT#: TP723399

Purified recombinant protein of Rat KIT ligand (Kitlg).

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MQEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
• Tag: Tag Free
• Predicted MW: 18.4 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by the dose-dependent stimulation of the proliferation of the human TF-1 cells. The expected ED50 for this effect is 20 - 40 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_068615
• Locus ID: 60427
• UniProt ID: P21581
• Cytogenetics: 7q21
• Refseq Size: 5360
• Refseq ORF: 819
• Synonyms: Kitl; Mgf; SCF
• Summary: soluble growth factor that activates c-kit tyrosine kinase receptor; important for signaling in spermatogenesis; putative regulator of Leydig cell development [RGD, Feb 2006]