SCGF (CLEC11A) (NM_002975) Human Recombinant Protein
CAT#: TP723401
Purified recombinant protein of Human C-type lectin domain family 11, member A (CLEC11A).
Product Images
![](https://cdn.origene.com/img/defaults-img.jpg)
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
|
Tag | Tag Free |
Predicted MW | 25 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its inhibitory effect on the proliferation of TF-1 cells previously grown in media containing GM-CSF. ED50 for this effect was observed at 7 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002966 |
Locus ID | 6320 |
UniProt ID | Q9Y240 |
Cytogenetics | 19q13.33 |
Refseq Size | 1423 |
Refseq ORF | 969 |
Synonyms | CLECSF3; LSLCL; P47; SCGF |
Summary | This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418980 | CLEC11A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418980 | Transient overexpression lysate of C-type lectin domain family 11, member A (CLEC11A) |
USD 396.00 |
|
TP723400 | Purified recombinant protein of Human C-type lectin domain family 11, member A (CLEC11A). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review