Cxcl12 (NM_001033882) Rat Recombinant Protein
CAT#: TP723407
Purified recombinant protein of Rat chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (Cxcl12), transcript variant 2.
Product Images
![](https://cdn.origene.com/img/defaults-img.jpg)
Specifications
Product Data | |
Species | Rat |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKSNNRQVCIDPKLKWIQEYLDKALNKRLKM
|
Tag | Tag Free |
Predicted MW | 8.4 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to chemoattract human monocytes using a concentration range of 100.0-200.0 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001029054 |
Locus ID | 24772 |
Cytogenetics | 4q42 |
Refseq Size | 2850 |
Refseq ORF | 279 |
Synonyms | Sdf1 |
Summary | a chemoattractant molecule; involved in cell migration [RGD, Feb 2006] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP527145 | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 12 (Cxcl12), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug |
USD 748.00 |
|
TP723403 | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 12 (Cxcl12), transcript variant 1. |
USD 240.00 |
|
TP723404 | Purified recombinant protein of Rat chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (Cxcl12), transcript variant 2. |
USD 240.00 |
|
TP723406 | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 12 (Cxcl12), transcript variant 1. |
USD 240.00 |
|
TP723771 | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 12 (Cxcl12 / SDF-1alpha), transcript variant 1 |
USD 265.00 |
|
TP723857 | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 12 (Cxcl12 / SDF-1beta), transcript variant 2 |
USD 265.00 |
{0} Product Review(s)
Be the first one to submit a review