Mydgf (NM_080837) Mouse Recombinant Protein

CAT#: TP723409

Purified recombinant protein of Mouse DNA segment, Chr 17, Wayne State University 104, expressed (D17Wsu104e).

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MVSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL
• Tag: Tag Free
• Predicted MW: 15.8 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_543027
• Locus ID: 28106
• UniProt ID: Q9CPT4
• Cytogenetics: 17 29.2 cM
• Refseq Size: 913
• Refseq ORF: 501
• Synonyms: D17Wsu104e; Il25; Ly6elg
• Summary: The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was identified in error as interleukin 25. This activity has not been reproducible, however, and the function of this protein is currently unknown. [provided by RefSeq, Jul 2008]