Shh (NM_009170) Mouse Recombinant Protein

CAT#: TP723417

Purified recombinant protein of Mouse sonic hedgehog (Shh).

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  IVIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
• Tag: Tag Free
• Predicted MW: 20 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >90% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to induce alkaline phosphatase production by C3H/10T1/2 (CCL-226) cells. The expected ED50 for this effect is 0.5-1.0ug/mL.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_033196
• Locus ID: 20423
• UniProt ID: Q62226
• Cytogenetics: 5 14.39 cM
• Refseq Size: 2727
• Refseq ORF: 1311
• Synonyms: 9530036O11Rik; Dsh; Hhg1; Hx; Hxl3; M100081; ShhNC