LTA (NM_000595) Human Recombinant Protein
CAT#: TP723454
Purified recombinant protein of Human lymphotoxin alpha (TNF superfamily, member 1) (LTA), transcript variant 2.
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
|
Tag | Tag Free |
Predicted MW | 18.6 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | ED50 as determined by the cytolysis of murine L929 cells in the presence of Actinomycin-D is less than or equal to 0.05 ng/ml, corresponding to a specific activity of > 2 x 10^7 units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000586 |
Locus ID | 4049 |
UniProt ID | P01374, Q5STV3 |
Cytogenetics | 6p21.33 |
Refseq Size | 1423 |
Refseq ORF | 615 |
Synonyms | LT; TNFB; TNFSF1; TNLG1E |
Summary | 'The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4, myocardial infarction, non-Hodgkin's lymphoma, and psoriatic arthritis. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012]' |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Antigen processing and presentation, Cytokine-cytokine receptor interaction, Type I diabetes mellitus |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424627 | LTA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC431786 | LTA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY424627 | Transient overexpression lysate of lymphotoxin alpha (TNF superfamily, member 1) (LTA), transcript variant 2 |
USD 325.00 |
|
LY431786 | Transient overexpression lysate of lymphotoxin alpha (TNF superfamily, member 1) (LTA), transcript variant 1 |
USD 325.00 |
|
PH303741 | LTA MS Standard C13 and N15-labeled recombinant protein (NP_000586) |
USD 2,055.00 |
|
TP303741 | Recombinant protein of human lymphotoxin alpha (TNF superfamily, member 1) (LTA) |
USD 439.00 |
|
TP328758 | Recombinant protein of human lymphotoxin alpha (TNF superfamily, member 1) (LTA), transcript variant 1. |
USD 748.00 |
|
TP720614 | Purified recombinant protein of Human lymphotoxin alpha (TNF superfamily, member 1) (LTA), transcript variant 2 |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review