Thpo (NM_009379) Mouse Recombinant Protein
CAT#: TP723457
Purified recombinant protein of Mouse thrombopoietin (Thpo), transcript variant 2.
Product Images
![](https://cdn.origene.com/img/defaults-img.jpg)
Other products for "Thpo"
Specifications
Product Data | |
Species | Mouse |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKF
|
Tag | Tag Free |
Predicted MW | 18.7 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | The ED50 was determined by the dose-dependent stimulation of the proliferation of human MO7e cells was found to be > 1.0 ng/ml, corresponding to a specific activity of > 1 x 10^6 units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_033405 |
Locus ID | 21832 |
UniProt ID | P40226, Q543R9 |
Cytogenetics | 16 12.51 cM |
Refseq Size | 2262 |
Refseq ORF | 1071 |
Synonyms | Mgdf; Ml; Mpllg; Tpo |
Summary | This gene encodes a humoral growth factor necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. The encoded protein is a ligand for the product of the myeloproliferative leukemia virus oncogene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.