Vegfa (NM_001025250) Mouse Recombinant Protein
CAT#: TP723469
Purified recombinant protein of Mouse vascular endothelial growth factor A (Vegfa), transcript variant 1.
Product Images
Specifications
Product Data | |
Species | Mouse |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
|
Tag | Tag Free |
Predicted MW | 39 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 1.0-5.0 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001103736 |
Locus ID | 22339 |
UniProt ID | Q00731, A0A1L1SVG2 |
Cytogenetics | 17 22.79 cM |
Refseq Size | 3547 |
Refseq ORF | 1176 |
Synonyms | Vegf; Vpf |
Summary | This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site. [provided by RefSeq, Nov 2015] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP723470 | Purified recombinant protein of Rat vascular endothelial growth factor A (Vegfa), transcript variant 5. |
USD 240.00 |
|
TP723783 | Purified recombinant protein of Mouse vascular endothelial growth factor A (Vegfa), transcript variant 2 |
USD 275.00 |
|
TP723803 | Purified recombinant protein of Mouse vascular endothelial growth factor A (Vegfa), transcript variant 2 |
USD 265.00 |
{0} Product Review(s)
Be the first one to submit a review