SARS-CoV-2 Papain-like Protease Recombinant Protein with His tag

CAT#: TP723923

SARS-CoV-2 Papain-like Protease Recombinant Protein with His tag

Specifications

Product Data

• Species: SARS-CoV-2
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  HHHHHHEVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK
• Tag: N-6xHis
• Purity: > 90% by SDS-PAGE.
• Buffer: Supplied as a 0.22 μm filtered solution in 20mM Tris,20% Glycerol,10mM β-Me，pH7.5.
• Endotoxin: < 1.0 EU/μg of the protein by LAL method.
• Protein Description: Recombinant 2019-nCoV papain-like protease is produced by E. coli expression system. The target protein is expressed with sequence (Glu1564-Lys1878) of 2019-ncov papain-like protease (Accession #YP_009725299.1) fused with an 6×His tag at the N-terminus.
• Storage: Store at -80°C.
• Stability: 6 months