Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-HNRPL Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPL antibody: synthetic peptide directed towards the N terminal of human HNRPL. Synthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV

Rabbit Polyclonal Anti-PABPN1 Antibody

Applications IF, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PABPN1 antibody: synthetic peptide directed towards the N terminal of human PABPN1. Synthetic peptide located within the following region: MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL