Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-GPR161 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the N terminal of human GPR161. Synthetic peptide located within the following region: MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVV

Rabbit Polyclonal Anti-GPR161 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the middle region of human GPR161. Synthetic peptide located within the following region: FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG