Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-GTPBP9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTPBP9 antibody: synthetic peptide directed towards the N terminal of human GTPBP9. Synthetic peptide located within the following region: QGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQ

Rabbit Polyclonal Anti-GTPBP9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTPBP9 antibody: synthetic peptide directed towards the N terminal of human GTPBP9. Synthetic peptide located within the following region: MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWND