Antibodies for $/€ 289

Jump to Filters
View as table Download
PRMT5 Rabbit Polyclonal Antibody
TA345675

USD 410.00

5 Days

Rabbit Polyclonal Anti-PRMT5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRMT5 antibody: synthetic peptide directed towards the N terminal of human PRMT5. Synthetic peptide located within the following region: FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS