Antibodies for $/€ 289

Jump to Filters
View as table Download
CSTF2T Rabbit Polyclonal Antibody
TA343827

USD 475.00

5 Days

Rabbit Polyclonal Anti-CSTF2T Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSTF2T antibody: synthetic peptide directed towards the C terminal of human CSTF2T. Synthetic peptide located within the following region: MRGPVPSSRGPMTGGIQGPGPINIGAGGPPQGPRQVPGISGVGNPGAGMQ
CSTF2T Rabbit Polyclonal Antibody
TA343826

USD 475.00

5 Days

Rabbit Polyclonal Anti-CSTF2T Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSTF2T antibody: synthetic peptide directed towards the C terminal of human CSTF2T. Synthetic peptide located within the following region: AGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVT