Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-SMNDC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMNDC1 antibody: synthetic peptide directed towards the middle region of human SMNDC1. Synthetic peptide located within the following region: QFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSK

Rabbit Polyclonal Anti-SMNDC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMNDC1 antibody: synthetic peptide directed towards the C terminal of human SMNDC1. Synthetic peptide located within the following region: KGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ