Antibodies for $/€ 289

Jump to Filters
View as table Download
INSIG1 Rabbit Polyclonal Antibody
TA345657

USD 475.00

5 Days

Rabbit Polyclonal Anti-INSIG1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-INSIG1 antibody: synthetic peptide directed towards the middle region of human INSIG1. Synthetic peptide located within the following region: ITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGR
Noradrenaline transporter (SLC6A2) Rabbit Polyclonal Antibody
TA346265

USD 475.00

5 Days

Rabbit Polyclonal Anti-SLC6A2 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC6A2 antibody: synthetic peptide directed towards the middle region of human SLC6A2. Synthetic peptide located within the following region: FTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVVIVLYFSLWKGV