Antibodies for $/€ 289

Jump to Filters
View as table Download
EGR1 Rabbit Polyclonal Antibody
TA344360

USD 475.00

5 Days

Rabbit Polyclonal Anti-EGR1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGR1 antibody: synthetic peptide directed towards the middle region of human EGR1. Synthetic peptide located within the following region: PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS