Antibodies for $/€ 289

Jump to Filters
View as table Download
PRAS40 (AKT1S1) Rabbit Polyclonal Antibody
TA346509

USD 475.00

5 Days

Rabbit Polyclonal Anti-AKT1S1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AKT1S1 antibody: synthetic peptide directed towards the C terminal of human AKT1S1. Synthetic peptide located within the following region: KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAE