Antibodies for $/€ 289

Jump to Filters
View as table Download
Cfl2 Rabbit Polyclonal Antibody
TA346655

USD 475.00

5 Days

Rabbit Polyclonal Anti-Cfl2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Cfl2 antibody is: synthetic peptide directed towards the C-terminal region of Cfl2. Synthetic peptide located within the following region: FWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEK