Antibodies for $/€ 289

Jump to Filters
View as table Download
Adnp2 Rabbit Polyclonal Antibody
TA343760

USD 475.00

5 Days

Rabbit Polyclonal Anti-Adnp2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Adnp2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Adnp2. Synthetic peptide located within the following region: MFQIPVQNLDNIRKVRKRVKGILVDIGLDSCKELLKDLKGFDPGEKYFCN