Antibodies for $/€ 289

Jump to Filters
View as table Download
mrpl24 Rabbit Polyclonal Antibody
TA343931

USD 475.00

5 Days

Rabbit Polyclonal Anti-mrpl24 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-mrpl24 antibody is: synthetic peptide directed towards the C-terminal region of Rat mrpl24. Synthetic peptide located within the following region: GIVPETWTDGPKDTSVEDALERTYVPRLKTLEEDVMEAMGIQETRRFKKI