Antibodies for $/€ 289

Jump to Filters
View as table Download
Pak4 Rabbit Polyclonal Antibody
TA346685

USD 475.00

5 Days

Rabbit Polyclonal Anti-Pak4 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Pak4 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACITSIQPGAPKTIVR