Antibodies for $/€ 289

Jump to Filters
View as table Download
PCID2 Rabbit Polyclonal Antibody
TA344864

USD 475.00

5 Days

Rabbit Polyclonal Anti-RGD1307041 Antibody - middle region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-RGD1307041 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVG