Antibodies for $/€ 289

Jump to Filters
View as table Download
Rbm8a Rabbit Polyclonal Antibody
TA345910

USD 475.00

5 Days

Rabbit Polyclonal Anti-Rbm8a Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Rbm8a antibody is: synthetic peptide directed towards the N-terminal region of Rat Rbm8a. Synthetic peptide located within the following region: EDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGD