Antibodies for $/€ 289

Jump to Filters
View as table Download
Selenof Rabbit Polyclonal Antibody
TA346588

USD 475.00

5 Days

Rabbit Polyclonal Anti-sep15 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-sep15 antibody is: synthetic peptide directed towards the C-terminal region of Rat sep15. Synthetic peptide located within the following region: LFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLER