Antibodies for $/€ 289

Jump to Filters
View as table Download
Stc1 Rabbit Polyclonal Antibody
TA346345

USD 475.00

5 Days

Rabbit Polyclonal Anti-Stc1 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Stc1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Stc1. Synthetic peptide located within the following region: EKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEG