Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-MST104 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MST104 antibody is: synthetic peptide directed towards the C-terminal region of Human MST104. Synthetic peptide located within the following region: EKGILIIQFLVIFPEKHWLSLEKLPQLEALLPPRQKVRITDDMDQVELKE

Rabbit Polyclonal Anti-DNAJA4 Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Dnaja4 antibody is: synthetic peptide directed towards the C-terminal region of Rat Dnaja4. Synthetic peptide located within the following region: IIEVHVDKGMKDGQKILFHGEGDQEPELEPGDVIIVLDQKDHSVFQRRGH