Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-PTBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the N terminal of human PTBP1. Synthetic peptide located within the following region: RGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHI

Rabbit Polyclonal Anti-PTBP1 Antibody

Applications WB
Reactivities Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish, Dog, Pig, Horse
Conjugation Unconjugated
Immunogen The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI