Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-RGD1310794 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-RGD1310794 antibody is: synthetic peptide directed towards the N-terminal region of Rat RGD1310794. Synthetic peptide located within the following region: NLESQYLLIQGVPAVGAMKELVERFALYGAIEQYNALDEYPAEDFTEVYL

Rabbit Polyclonal Anti-DKFZP564O0523 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DKFZP564O0523 antibody: synthetic peptide directed towards the C terminal of human DKFZP564O0523. Synthetic peptide located within the following region: FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK