Rabbit Polyclonal Anti-RBM8A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBM8A antibody: synthetic peptide directed towards the N terminal of human RBM8A. Synthetic peptide located within the following region: LHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDS |
Rabbit Polyclonal Anti-Rbm8a Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Rbm8a antibody is: synthetic peptide directed towards the N-terminal region of Rat Rbm8a. Synthetic peptide located within the following region: EDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGD |
Germany
Japan
United Kingdom
China
